Lineage for d1xfna_ (1xfn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665549Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1665550Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 1665622Protein automated matches [254452] (1 species)
    not a true protein
  7. 1665623Species Halorhodospira halophila [TaxId:1053] [254966] (2 PDB entries)
  8. 1665624Domain d1xfna_: 1xfn A: [121934]
    automated match to d1otda_
    complexed with hc4

Details for d1xfna_

PDB Entry: 1xfn (more details)

PDB Description: nmr structure of the ground state of the photoactive yellow protein lacking the n-terminal part
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1xfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfna_ d.110.3.1 (A:) automated matches {Halorhodospira halophila [TaxId: 1053]}
lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

SCOPe Domain Coordinates for d1xfna_:

Click to download the PDB-style file with coordinates for d1xfna_.
(The format of our PDB-style files is described here.)

Timeline for d1xfna_: