Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254965] (1 PDB entry) |
Domain d1xfbj_: 1xfb J: [121931] Other proteins in same PDB: d1xfba1 automated match to d1ewda_ |
PDB Entry: 1xfb (more details), 3 Å
SCOPe Domain Sequences for d1xfbj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfbj_ c.1.10.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy gralqasalnawrgqrdnagaateefikraevnglaaqgkye
Timeline for d1xfbj_: