Lineage for d1xf8a2 (1xf8 A:165-335)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 731367Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (2 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 731372Protein Peptidyltransferase FemX [103177] (1 species)
  7. 731373Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 731379Domain d1xf8a2: 1xf8 A:165-335 [121921]
    automatically matched to d1ne9a2
    complexed with mg; mutant

Details for d1xf8a2

PDB Entry: 1xf8 (more details), 1.9 Å

PDB Description: crystal structure of weissella viridescens femx (y254f) mutant
PDB Compounds: (A:) FemX

SCOP Domain Sequences for d1xf8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xf8a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwfmyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd

SCOP Domain Coordinates for d1xf8a2:

Click to download the PDB-style file with coordinates for d1xf8a2.
(The format of our PDB-style files is described here.)

Timeline for d1xf8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xf8a1