SCOPe 2.08: Domain d1xf8a1: 1xf8 A:1-164

Lineage for d1xf8a1 (1xf8 A:1-164)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein Peptidyltransferase FemX [103177] (1 species)

7. Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)

8. Domain d1xf8a1: 1xf8 A:1-164 [121920]
   automatically matched to d1ne9a1
   complexed with mg; mutant

Details for d1xf8a1

PDB Entry: 1xf8, 1.9 Å

PDB Description: crystal structure of weissella viridescens femx (y254f) mutant

PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1xf8a1:

Sequence; same for both SEQRES and ATOM records:

>d1xf8a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

Timeline for d1xf8a1:

• d1xf8a1 first appeared in SCOP 1.73
  
• d1xf8a1 appears in SCOPe 2.07