Lineage for d1xeqa1 (1xeq A:15-103)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764627Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (1 protein)
  6. 764628Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (2 species)
  7. 764633Species Influenza B virus [TaxId:11520] [140389] (1 PDB entry)
    Uniprot P03502 15-103
  8. 764634Domain d1xeqa1: 1xeq A:15-103 [121915]
    complexed with br

Details for d1xeqa1

PDB Entry: 1xeq (more details), 2.1 Å

PDB Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein
PDB Compounds: (A:) Nonstructural protein NS1

SCOP Domain Sequences for d1xeqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeqa1 a.16.1.1 (A:15-103) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]}
gatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepenkrmsl
eerkaigvkmmkvllfmdpsagiegfepy

SCOP Domain Coordinates for d1xeqa1:

Click to download the PDB-style file with coordinates for d1xeqa1.
(The format of our PDB-style files is described here.)

Timeline for d1xeqa1: