SCOP 1.73: Domain d1xema1: 1xem A:1-164

Lineage for d1xema1 (1xem A:1-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Escherichia coli [TaxId:562] [56423] (19 PDB entries)

8. Domain d1xema1: 1xem A:1-164 [121911]
   automatically matched to d1bs4a_
   complexed with fmt, zn

Details for d1xema1

PDB Entry: 1xem, 1.76 Å

PDB Description: High Resolution Crystal Structure of Escherichia coli Zinc- Peptide Deformylase bound to formate

PDB Compounds: (A:) Peptide deformylase

SCOP Domain Sequences for d1xema1:

Sequence; same for both SEQRES and ATOM records:

>d1xema1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

Timeline for d1xema1:

• d1xema1 is new in SCOP 1.73
  
• d1xema1 appears in SCOP 1.75
  
• d1xema1 appears in the current release, SCOPe 2.08, called d1xema_