Lineage for d1xe6b_ (1xe6 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802130Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2802131Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2802165Domain d1xe6b_: 1xe6 B: [121909]
    automated match to d1leea_
    complexed with 5fp

Details for d1xe6b_

PDB Entry: 1xe6 (more details), 2.8 Å

PDB Description: Structure of plasmepsin II in complex of an pepstatin analogue
PDB Compounds: (B:) Plasmepsin 2

SCOPe Domain Sequences for d1xe6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xe6b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d1xe6b_:

Click to download the PDB-style file with coordinates for d1xe6b_.
(The format of our PDB-style files is described here.)

Timeline for d1xe6b_: