Lineage for d1xe5b1 (1xe5 B:1-329)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804499Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 804754Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 804755Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (17 PDB entries)
  8. 804770Domain d1xe5b1: 1xe5 B:1-329 [121907]
    automatically matched to d1lf3a_
    complexed with 5fe

Details for d1xe5b1

PDB Entry: 1xe5 (more details), 2.4 Å

PDB Description: Structure of plasmepsin II in complex of an pepstatin analogue
PDB Compounds: (B:) Plasmepsin 2

SCOP Domain Sequences for d1xe5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xe5b1 b.50.1.2 (B:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1xe5b1:

Click to download the PDB-style file with coordinates for d1xe5b1.
(The format of our PDB-style files is described here.)

Timeline for d1xe5b1: