SCOPe 2.08: Domain d1xe5a_: 1xe5 A:

Lineage for d1xe5a_ (1xe5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)

8. Domain d1xe5a_: 1xe5 A: [121906]
   automated match to d1leea_
   complexed with 5fe

Details for d1xe5a_

PDB Entry: 1xe5, 2.4 Å

PDB Description: Structure of plasmepsin II in complex of an pepstatin analogue

PDB Compounds: (A:) Plasmepsin 2

SCOPe Domain Sequences for d1xe5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xe5a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1xe5a_:

• d1xe5a_ first appeared in SCOP 1.73, called d1xe5a1
  
• d1xe5a_ appears in SCOPe 2.07