SCOPe 2.05: Domain d1xe4a2: 1xe4 A:165-335

Lineage for d1xe4a2 (1xe4 A:165-335)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein Peptidyltransferase FemX [103177] (1 species)

7. Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)

8. Domain d1xe4a2: 1xe4 A:165-335 [121905]
   automatically matched to d1ne9a2
   complexed with mg; mutant

Details for d1xe4a2

PDB Entry: 1xe4, 1.95 Å

PDB Description: crystal structure of weissella viridescens femx (k36m) mutant

PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1xe4a2:

Sequence; same for both SEQRES and ATOM records:

>d1xe4a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd

Timeline for d1xe4a2:

• d1xe4a2 first appeared in SCOP 1.73
  
• d1xe4a2 appears in SCOPe 2.04
  
• d1xe4a2 appears in SCOPe 2.06
  
• d1xe4a2 appears in the current release, SCOPe 2.08