Lineage for d1xe4a1 (1xe4 A:1-164)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533683Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2533694Protein Peptidyltransferase FemX [103177] (1 species)
  7. 2533695Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 2533704Domain d1xe4a1: 1xe4 A:1-164 [121904]
    automatically matched to d1ne9a1
    complexed with mg; mutant

Details for d1xe4a1

PDB Entry: 1xe4 (more details), 1.95 Å

PDB Description: Crystal Structure of Weissella viridescens FemX (K36M) Mutant
PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1xe4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xe4a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvmnnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

SCOPe Domain Coordinates for d1xe4a1:

Click to download the PDB-style file with coordinates for d1xe4a1.
(The format of our PDB-style files is described here.)

Timeline for d1xe4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xe4a2