Lineage for d1xdpb4 (1xdp B:502-688)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734041Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 734042Superfamily d.136.1: Phospholipase D/nuclease [56024] (4 families) (S)
  5. 734125Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 734126Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 734127Species Escherichia coli [TaxId:562] [143863] (2 PDB entries)
  8. 734131Domain d1xdpb4: 1xdp B:502-688 [121903]
    Other proteins in same PDB: d1xdpa1, d1xdpa2, d1xdpb1, d1xdpb2
    automatically matched to 1XDO A:502-688
    complexed with atp, mg

Details for d1xdpb4

PDB Entry: 1xdp (more details), 2.5 Å

PDB Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP
PDB Compounds: (B:) Polyphosphate kinase

SCOP Domain Sequences for d1xdpb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdpb4 d.136.1.4 (B:502-688) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
ylmvspqnsrrllyemvdreianaqqglpsgitlklnnlvdkglvdrlyaasssgvpvnl
lvrgmcslipnlegisdniraisivdrylehdrvyifenggdkkvylssadwmtrnidyr
ievatplldprlkqrvldiidilfsdtvkaryidkelsnryvprgnrrkvraqlaiydyi
ksleqpe

SCOP Domain Coordinates for d1xdpb4:

Click to download the PDB-style file with coordinates for d1xdpb4.
(The format of our PDB-style files is described here.)

Timeline for d1xdpb4: