Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
Superfamily d.136.1: Phospholipase D/nuclease [56024] (4 families) |
Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein) C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer |
Protein Polyphosphate kinase, PPK [143861] (2 species) |
Species Escherichia coli [TaxId:562] [143863] (2 PDB entries) |
Domain d1xdpb4: 1xdp B:502-688 [121903] Other proteins in same PDB: d1xdpa1, d1xdpa2, d1xdpb1, d1xdpb2 automatically matched to 1XDO A:502-688 complexed with atp, mg |
PDB Entry: 1xdp (more details), 2.5 Å
SCOP Domain Sequences for d1xdpb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdpb4 d.136.1.4 (B:502-688) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]} ylmvspqnsrrllyemvdreianaqqglpsgitlklnnlvdkglvdrlyaasssgvpvnl lvrgmcslipnlegisdniraisivdrylehdrvyifenggdkkvylssadwmtrnidyr ievatplldprlkqrvldiidilfsdtvkaryidkelsnryvprgnrrkvraqlaiydyi ksleqpe
Timeline for d1xdpb4:
View in 3D Domains from other chains: (mouse over for more information) d1xdpa1, d1xdpa2, d1xdpa3, d1xdpa4 |