Class a: All alpha proteins [46456] (258 folds) |
Fold a.7: Spectrin repeat-like [46965] (15 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family) |
Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein) N-terminal part of Pfam PF02503 this is a repeat family; one repeat unit is 2o8r B:11-112 found in domain |
Protein Polyphosphate kinase, PPK [140358] (2 species) |
Species Escherichia coli [TaxId:562] [140359] (2 PDB entries) |
Domain d1xdpb1: 1xdp B:2-106 [121900] Other proteins in same PDB: d1xdpa2, d1xdpa3, d1xdpa4, d1xdpb2, d1xdpb3, d1xdpb4 automatically matched to 1XDO A:2-106 complexed with atp, mg |
PDB Entry: 1xdp (more details), 2.5 Å
SCOP Domain Sequences for d1xdpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdpb1 a.7.15.1 (B:2-106) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]} gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnq
Timeline for d1xdpb1:
View in 3D Domains from other chains: (mouse over for more information) d1xdpa1, d1xdpa2, d1xdpa3, d1xdpa4 |