SCOPe 2.08: Domain d1xdpb1: 1xdp B:2-106

Lineage for d1xdpb1 (1xdp B:2-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family)
   automatically mapped to Pfam PF13089

5. Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein)
   N-terminal part of Pfam PF02503
   this is a repeat family; one repeat unit is 2o8r B:11-112 found in domain

6. Protein Polyphosphate kinase, PPK [140358] (2 species)

7. Species Escherichia coli [TaxId:562] [140359] (2 PDB entries)
   Uniprot P0A7B1 2-106

8. Domain d1xdpb1: 1xdp B:2-106 [121900]
   Other proteins in same PDB: d1xdpa2, d1xdpa3, d1xdpa4, d1xdpb2, d1xdpb3, d1xdpb4
   automated match to d1xdoa1
   complexed with atp, mg

Details for d1xdpb1

PDB Entry: 1xdp, 2.5 Å

PDB Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP

PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdpb1:

Sequence; same for both SEQRES and ATOM records:

>d1xdpb1 a.7.15.1 (B:2-106) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnq

Timeline for d1xdpb1:

• d1xdpb1 first appeared in SCOP 1.73
  
• d1xdpb1 appears in SCOPe 2.07