Lineage for d1xdpb1 (1xdp B:2-106)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985596Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family) (S)
    automatically mapped to Pfam PF13089
  5. 1985597Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein)
    N-terminal part of Pfam PF02503
  6. 1985598Protein Polyphosphate kinase, PPK [140358] (2 species)
  7. 1985599Species Escherichia coli [TaxId:562] [140359] (2 PDB entries)
    Uniprot P0A7B1 2-106
  8. 1985601Domain d1xdpb1: 1xdp B:2-106 [121900]
    Other proteins in same PDB: d1xdpa2, d1xdpa3, d1xdpa4, d1xdpb2, d1xdpb3, d1xdpb4
    automated match to d1xdoa1
    complexed with atp, mg

Details for d1xdpb1

PDB Entry: 1xdp (more details), 2.5 Å

PDB Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP
PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdpb1 a.7.15.1 (B:2-106) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnq

SCOPe Domain Coordinates for d1xdpb1:

Click to download the PDB-style file with coordinates for d1xdpb1.
(The format of our PDB-style files is described here.)

Timeline for d1xdpb1: