SCOPe 2.05: Domain d1xdpa2: 1xdp A:107-314

Lineage for d1xdpa2 (1xdp A:107-314)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.322: PHP14-like [143723] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest

4. Superfamily d.322.1: PHP14-like [143724] (2 families)

5. Family d.322.1.2: PPK middle domain-like [143728] (1 protein)
   central part of Pfam PF02503

6. Protein Polyphosphate kinase, PPK [143729] (2 species)

7. Species Escherichia coli [TaxId:562] [143731] (2 PDB entries)
   Uniprot P0A7B1 107-314

8. Domain d1xdpa2: 1xdp A:107-314 [121897]
   Other proteins in same PDB: d1xdpa1, d1xdpa3, d1xdpa4, d1xdpb1, d1xdpb3, d1xdpb4
   automated match to d1xdoa2
   complexed with atp, mg

Details for d1xdpa2

PDB Entry: 1xdp, 2.5 Å

PDB Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP

PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdpa2:

Sequence; same for both SEQRES and ATOM records:

>d1xdpa2 d.322.1.2 (A:107-314) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
iflinerqlsvnqqnwlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdt
iryalleipsdkvprfvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmk
mtrdaeydlvhemeaslmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisryd
sivpggryhnfkdfinfpnvgkanlvnk

Timeline for d1xdpa2:

• d1xdpa2 first appeared in SCOP 1.73
  
• d1xdpa2 appears in SCOPe 2.04
  
• d1xdpa2 appears in SCOPe 2.06
  
• d1xdpa2 appears in the current release, SCOPe 2.08