Lineage for d1xdob4 (1xdo B:502-688)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216818Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 2216819Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 2216820Species Escherichia coli [TaxId:562] [143863] (2 PDB entries)
    Uniprot P0A7B1 315-501! Uniprot P0A7B1 502-688
  8. 2216828Domain d1xdob4: 1xdo B:502-688 [121895]
    Other proteins in same PDB: d1xdoa1, d1xdoa2, d1xdob1, d1xdob2
    automated match to d1xdpa4

Details for d1xdob4

PDB Entry: 1xdo (more details), 3 Å

PDB Description: crystal structure of escherichia coli polyphosphate kinase
PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdob4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdob4 d.136.1.4 (B:502-688) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
ylmvspqnsrrllyemvdreianaqqglpsgitlklnnlvdkglvdrlyaasssgvpvnl
lvrgmcslipnlegisdniraisivdrylehdrvyifenggdkkvylssadwmtrnidyr
ievatplldprlkqrvldiidilfsdtvkaryidkelsnryvprgnrrkvraqlaiydyi
ksleqpe

SCOPe Domain Coordinates for d1xdob4:

Click to download the PDB-style file with coordinates for d1xdob4.
(The format of our PDB-style files is described here.)

Timeline for d1xdob4: