![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.322: PHP14-like [143723] (1 superfamily) beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest |
![]() | Superfamily d.322.1: PHP14-like [143724] (2 families) ![]() |
![]() | Family d.322.1.2: PPK middle domain-like [143728] (1 protein) central part of Pfam PF02503 |
![]() | Protein Polyphosphate kinase, PPK [143729] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [143731] (2 PDB entries) Uniprot P0A7B1 107-314 |
![]() | Domain d1xdob2: 1xdo B:107-314 [121893] Other proteins in same PDB: d1xdoa1, d1xdoa3, d1xdoa4, d1xdob1, d1xdob3, d1xdob4 automated match to d1xdpa2 |
PDB Entry: 1xdo (more details), 3 Å
SCOPe Domain Sequences for d1xdob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdob2 d.322.1.2 (B:107-314) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]} iflinerqlsvnqqnwlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdt iryalleipsdkvprfvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmk mtrdaeydlvhemeaslmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisryd sivpggryhnfkdfinfpnvgkanlvnk
Timeline for d1xdob2:
![]() Domains from other chains: (mouse over for more information) d1xdoa1, d1xdoa2, d1xdoa3, d1xdoa4 |