Lineage for d1xdoa3 (1xdo A:315-501)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977836Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2977837Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2978050Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 2978051Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 2978052Species Escherichia coli [TaxId:562] [143863] (2 PDB entries)
    Uniprot P0A7B1 315-501! Uniprot P0A7B1 502-688
  8. 2978057Domain d1xdoa3: 1xdo A:315-501 [121890]
    Other proteins in same PDB: d1xdoa1, d1xdoa2, d1xdob1, d1xdob2

Details for d1xdoa3

PDB Entry: 1xdo (more details), 3 Å

PDB Description: crystal structure of escherichia coli polyphosphate kinase
PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdoa3 d.136.1.4 (A:315-501) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
plprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqasfdpsvlaikiniy
rvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrlteagvhvifsapglki
haklflisrkengevvryahigtgnfnektarlytdyslltadaritnevrrvfnfienp
yrpvtfd

SCOPe Domain Coordinates for d1xdoa3:

Click to download the PDB-style file with coordinates for d1xdoa3.
(The format of our PDB-style files is described here.)

Timeline for d1xdoa3: