Lineage for d1xdoa2 (1xdo A:107-314)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010920Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 3010921Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 3010932Family d.322.1.2: PPK middle domain-like [143728] (1 protein)
    central part of Pfam PF02503
  6. 3010933Protein Polyphosphate kinase, PPK [143729] (2 species)
  7. 3010934Species Escherichia coli [TaxId:562] [143731] (2 PDB entries)
    Uniprot P0A7B1 107-314
  8. 3010937Domain d1xdoa2: 1xdo A:107-314 [121889]
    Other proteins in same PDB: d1xdoa1, d1xdoa3, d1xdoa4, d1xdob1, d1xdob3, d1xdob4

Details for d1xdoa2

PDB Entry: 1xdo (more details), 3 Å

PDB Description: crystal structure of escherichia coli polyphosphate kinase
PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdoa2 d.322.1.2 (A:107-314) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
iflinerqlsvnqqnwlrhyfkqylrqhitpilinpdtdlvqflkddytylaveiirgdt
iryalleipsdkvprfvnlppeaprrrkpmilldnilryclddifkgffdydalnaysmk
mtrdaeydlvhemeaslmelmssslkqrltaepvrfvyqrdmpnalvevlrekltisryd
sivpggryhnfkdfinfpnvgkanlvnk

SCOPe Domain Coordinates for d1xdoa2:

Click to download the PDB-style file with coordinates for d1xdoa2.
(The format of our PDB-style files is described here.)

Timeline for d1xdoa2: