Lineage for d1xdoa1 (1xdo A:2-106)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696925Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family) (S)
    automatically mapped to Pfam PF13089
  5. 2696926Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein)
    N-terminal part of Pfam PF02503
    this is a repeat family; one repeat unit is 2o8r B:11-112 found in domain
  6. 2696927Protein Polyphosphate kinase, PPK [140358] (2 species)
  7. 2696928Species Escherichia coli [TaxId:562] [140359] (2 PDB entries)
    Uniprot P0A7B1 2-106
  8. 2696931Domain d1xdoa1: 1xdo A:2-106 [121888]
    Other proteins in same PDB: d1xdoa2, d1xdoa3, d1xdoa4, d1xdob2, d1xdob3, d1xdob4

Details for d1xdoa1

PDB Entry: 1xdo (more details), 3 Å

PDB Description: crystal structure of escherichia coli polyphosphate kinase
PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdoa1 a.7.15.1 (A:2-106) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
gqeklyiekelswlsfnervlqeaadksnpliermrflgiysnnldefykvrfaelkrri
iiseeqgsnshsrhllgkiqsrvlkadqefdglynelllemarnq

SCOPe Domain Coordinates for d1xdoa1:

Click to download the PDB-style file with coordinates for d1xdoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xdoa1: