![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species) |
![]() | Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries) |
![]() | Domain d1xdhb_: 1xdh B: [121871] automated match to d1leea_ |
PDB Entry: 1xdh (more details), 1.7 Å
SCOPe Domain Sequences for d1xdhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdhb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi lgdpfmrkyftvfdydnhsvgialakknl
Timeline for d1xdhb_: