SCOPe 2.04: Domain d1xdha_: 1xdh A:

Lineage for d1xdha_ (1xdh A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (19 PDB entries)

8. Domain d1xdha_: 1xdh A: [121870]
   automated match to d1leea_

Details for d1xdha_

PDB Entry: 1xdh, 1.7 Å

PDB Description: Structure of plasmepsin II in complex with pepstatin A

PDB Compounds: (A:) Plasmepsin 2

SCOPe Domain Sequences for d1xdha_:

Sequence; same for both SEQRES and ATOM records:

>d1xdha_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1xdha_:

• d1xdha_ first appeared in SCOP 1.73, called d1xdha1
  
• d1xdha_ appears in SCOPe 2.03
  
• d1xdha_ appears in SCOPe 2.05
  
• d1xdha_ appears in the current release, SCOPe 2.08