Lineage for d1xdha_ (1xdh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393658Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2393659Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2393661Domain d1xdha_: 1xdh A: [121870]
    automated match to d1leea_

Details for d1xdha_

PDB Entry: 1xdh (more details), 1.7 Å

PDB Description: Structure of plasmepsin II in complex with pepstatin A
PDB Compounds: (A:) Plasmepsin 2

SCOPe Domain Sequences for d1xdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdha_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d1xdha_:

Click to download the PDB-style file with coordinates for d1xdha_.
(The format of our PDB-style files is described here.)

Timeline for d1xdha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xdhb_