![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein Plant pathogenesis-related protein PR10 [75543] (2 species) |
![]() | Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries) |
![]() | Domain d1xdfb_: 1xdf B: [121869] automated match to d1icxa_ complexed with epe, na |
PDB Entry: 1xdf (more details), 1.9 Å
SCOPe Domain Sequences for d1xdfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdfb_ d.129.3.1 (B:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie tkgdaqpneeegkaakargdaffkaienylsahpeyn
Timeline for d1xdfb_: