SCOPe 2.08: Domain d1xdfb_: 1xdf B:

Lineage for d1xdfb_ (1xdf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Plant pathogenesis-related protein PR10 [75543] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)

8. Domain d1xdfb_: 1xdf B: [121869]
   automated match to d1icxa_
   complexed with epe, na

Details for d1xdfb_

PDB Entry: 1xdf, 1.9 Å

PDB Description: Crystal structure of pathogenesis-related protein LlPR-10.2A from yellow lupine

PDB Compounds: (B:) pr10.2a

SCOPe Domain Sequences for d1xdfb_:

Sequence; same for both SEQRES and ATOM records:

>d1xdfb_ d.129.3.1 (B:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg
getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaienylsahpeyn

Timeline for d1xdfb_:

• d1xdfb_ first appeared in SCOP 1.73, called d1xdfb1
  
• d1xdfb_ appears in SCOPe 2.07