Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein Plant pathogenesis-related protein PR10 [75543] (2 species) |
Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries) |
Domain d1xdfa1: 1xdf A:1-157 [121868] isoform llpr10.2a complexed with epe, na |
PDB Entry: 1xdf (more details), 1.9 Å
SCOPe Domain Sequences for d1xdfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie tkgdaqpneeegkaakargdaffkaienylsahpeyn
Timeline for d1xdfa1: