SCOPe 2.08: Domain d1xdfa1: 1xdf A:1-157

Lineage for d1xdfa1 (1xdf A:1-157)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Plant pathogenesis-related protein PR10 [75543] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)

8. Domain d1xdfa1: 1xdf A:1-157 [121868]
   isoform llpr10.2a
   complexed with epe, na

Details for d1xdfa1

PDB Entry: 1xdf, 1.9 Å

PDB Description: Crystal structure of pathogenesis-related protein LlPR-10.2A from yellow lupine

PDB Compounds: (A:) pr10.2a

SCOPe Domain Sequences for d1xdfa1:

Sequence; same for both SEQRES and ATOM records:

>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfedeststiaparlykalvkdadaiipkaveaiqsietvegnggpgtikkltlieg
getkyvlhkieavdeanlrynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaienylsahpeyn

Timeline for d1xdfa1:

• d1xdfa1 first appeared in SCOP 1.73
  
• d1xdfa1 appears in SCOPe 2.07