SCOP 1.75: Domain d1xdcb2: 1xdc B:84-198

Lineage for d1xdcb2 (1xdc B:84-198)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)

8. Domain d1xdcb2: 1xdc B:84-198 [121867]
   Other proteins in same PDB: d1xdca1, d1xdcb1
   automatically matched to d1em1a2
   complexed with mn, yof

Details for d1xdcb2

PDB Entry: 1xdc, 1.85 Å

PDB Description: Hydrogen Bonding in Human Manganese Superoxide Dismutase containing 3-Fluorotyrosine

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1xdcb2:

Sequence; same for both SEQRES and ATOM records:

>d1xdcb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1xdcb2:

• d1xdcb2 first appeared in SCOP 1.73
  
• d1xdcb2 appears in SCOPe 2.01
  
• d1xdcb2 appears in the current release, SCOPe 2.08