SCOP 1.73: Domain d1xdcb1: 1xdc B:1-83

Lineage for d1xdcb1 (1xdc B:1-83)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries)

8. Domain d1xdcb1: 1xdc B:1-83 [121866]
   Other proteins in same PDB: d1xdca2, d1xdcb2
   automatically matched to d1em1a1
   complexed with mn, yof

Details for d1xdcb1

PDB Entry: 1xdc, 1.85 Å

PDB Description: Hydrogen Bonding in Human Manganese Superoxide Dismutase containing 3-Fluorotyrosine

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1xdcb1:

Sequence; same for both SEQRES and ATOM records:

>d1xdcb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1xdcb1:

• d1xdcb1 is new in SCOP 1.73
  
• d1xdcb1 appears in SCOP 1.75
  
• d1xdcb1 appears in the current release, SCOPe 2.08