![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries) |
![]() | Domain d1xdca1: 1xdc A:1-83 [121864] Other proteins in same PDB: d1xdca2, d1xdcb2 automatically matched to d1em1a1 complexed with mn, yof |
PDB Entry: 1xdc (more details), 1.85 Å
SCOP Domain Sequences for d1xdca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdca1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1xdca1: