Lineage for d1xcva2 (1xcv A:65-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001474Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2001475Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2001476Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 protein domains)
  6. 2001477Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2001478Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2001489Domain d1xcva2: 1xcv A:65-139 [121863]
    Other proteins in same PDB: d1xcva1
    automated match to d2tdxa2
    protein/DNA complex; complexed with ni; mutant

Details for d1xcva2

PDB Entry: 1xcv (more details), 2.1 Å

PDB Description: Crystal Structure Of (H79AC102D)Dtxr complexed with Nickel(II)
PDB Compounds: (A:) Diphtheria toxin repressor mutant

SCOPe Domain Sequences for d1xcva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcva2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkarlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

SCOPe Domain Coordinates for d1xcva2:

Click to download the PDB-style file with coordinates for d1xcva2.
(The format of our PDB-style files is described here.)

Timeline for d1xcva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xcva1