SCOPe 2.08: Domain d1xcva2: 1xcv A:65-139

Lineage for d1xcva2 (1xcv A:65-139)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
   Uniprot P33120

8. Domain d1xcva2: 1xcv A:65-139 [121863]
   Other proteins in same PDB: d1xcva1
   automated match to d2tdxa2
   protein/DNA complex; complexed with ni; mutant

Details for d1xcva2

PDB Entry: 1xcv, 2.1 Å

PDB Description: crystal structure of (h79ac102d)dtxr complexed with nickel(ii)

PDB Compounds: (A:) Diphtheria toxin repressor mutant

SCOPe Domain Sequences for d1xcva2:

Sequence; same for both SEQRES and ATOM records:

>d1xcva2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkarlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

Timeline for d1xcva2:

• d1xcva2 first appeared in SCOP 1.73
  
• d1xcva2 appears in SCOPe 2.07