Lineage for d1xcva1 (1xcv A:1-64)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982775Family a.4.5.24: Iron-dependent repressor protein [46882] (4 protein domains)
    automatically mapped to Pfam PF01325
  6. 1982776Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1982777Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 1982788Domain d1xcva1: 1xcv A:1-64 [121862]
    Other proteins in same PDB: d1xcva2
    automated match to d1p92a1
    protein/DNA complex; complexed with ni; mutant

Details for d1xcva1

PDB Entry: 1xcv (more details), 2.1 Å

PDB Description: Crystal Structure Of (H79AC102D)Dtxr complexed with Nickel(II)
PDB Compounds: (A:) Diphtheria toxin repressor mutant

SCOPe Domain Sequences for d1xcva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcva1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

SCOPe Domain Coordinates for d1xcva1:

Click to download the PDB-style file with coordinates for d1xcva1.
(The format of our PDB-style files is described here.)

Timeline for d1xcva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xcva2