SCOPe 2.08: Domain d1xcva1: 1xcv A:1-64

Lineage for d1xcva1 (1xcv A:1-64)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d1xcva1: 1xcv A:1-64 [121862]
   Other proteins in same PDB: d1xcva2
   automated match to d1p92a1
   protein/DNA complex; complexed with ni; mutant

Details for d1xcva1

PDB Entry: 1xcv, 2.1 Å

PDB Description: crystal structure of (h79ac102d)dtxr complexed with nickel(ii)

PDB Compounds: (A:) Diphtheria toxin repressor mutant

SCOPe Domain Sequences for d1xcva1:

Sequence; same for both SEQRES and ATOM records:

>d1xcva1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
slqm

Timeline for d1xcva1:

• d1xcva1 first appeared in SCOP 1.73
  
• d1xcva1 appears in SCOPe 2.07