SCOPe 2.08: Domain d1xcpc1: 1xcp C:1-289

Lineage for d1xcpc1 (1xcp C:1-289)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries)

8. Domain d1xcpc1: 1xcp C:1-289 [121858]
   automatically matched to d1de0a_
   complexed with adp, mg, sf4

Details for d1xcpc1

PDB Entry: 1xcp, 3.2 Å

PDB Description: crystal structure of the nitrogenase fe protein phe135trp with mgadp bound

PDB Compounds: (C:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xcpc1:

Sequence; same for both SEQRES and ATOM records:

>d1xcpc1 c.37.1.10 (C:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggwampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1xcpc1:

• d1xcpc1 first appeared in SCOP 1.73
  
• d1xcpc1 appears in SCOPe 2.07