Lineage for d1xcpa1 (1xcp A:1-289)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364310Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1364522Protein Nitrogenase iron protein [52661] (2 species)
  7. 1364523Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)
  8. 1364566Domain d1xcpa1: 1xcp A:1-289 [121856]
    automatically matched to d1de0a_
    complexed with adp, mg, sf4

Details for d1xcpa1

PDB Entry: 1xcp (more details), 3.2 Å

PDB Description: crystal structure of the nitrogenase fe protein phe135trp with mgadp bound
PDB Compounds: (A:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xcpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcpa1 c.37.1.10 (A:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggwampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOPe Domain Coordinates for d1xcpa1:

Click to download the PDB-style file with coordinates for d1xcpa1.
(The format of our PDB-style files is described here.)

Timeline for d1xcpa1: