Lineage for d1xc8a1 (1xc8 A:132-222)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779340Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 779341Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 779357Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
    Uniprot P42371
  8. 779362Domain d1xc8a1: 1xc8 A:132-222 [121852]
    Other proteins in same PDB: d1xc8a2, d1xc8a3
    automatically matched to d1pjja1
    complexed with fox, gol, zn

Details for d1xc8a1

PDB Entry: 1xc8 (more details), 1.95 Å

PDB Description: crystal structure complex between the wild-type lactococcus lactis fpg (mutm) and a fapy-dg containing dna
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOP Domain Sequences for d1xc8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc8a1 a.156.1.2 (A:132-222) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssirty

SCOP Domain Coordinates for d1xc8a1:

Click to download the PDB-style file with coordinates for d1xc8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xc8a1: