Lineage for d1xbza1 (1xbz A:3-215)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681365Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 681366Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
  8. 681391Domain d1xbza1: 1xbz A:3-215 [121848]
    automatically matched to 1XBX A:3-215
    complexed with lx1, mg; mutant

Details for d1xbza1

PDB Entry: 1xbz (more details), 1.8 Å

PDB Description: crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate
PDB Compounds: (A:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOP Domain Sequences for d1xbza1:

Sequence, based on SEQRES records: (download)

>d1xbza1 c.1.2.3 (A:3-215) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa
qqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

Sequence, based on observed residues (ATOM records): (download)

>d1xbza1 c.1.2.3 (A:3-215) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa
qqwrdagigqvvyhrsvdaqvawgeaditaikrlsdmgfkvtvagglaledlplfkgipi
hvfiagrsirdaaspveaarqfkrsiaelw

SCOP Domain Coordinates for d1xbza1:

Click to download the PDB-style file with coordinates for d1xbza1.
(The format of our PDB-style files is described here.)

Timeline for d1xbza1: