SCOPe 2.08: Domain d1xbyb_: 1xby B:

Lineage for d1xbyb_ (1xby B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)

7. Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
   Uniprot P39304

8. Domain d1xbyb_: 1xby B: [121847]
   automated match to d1kv8b_
   complexed with 5rp, mg; mutant

Details for d1xbyb_

PDB Entry: 1xby, 1.58 Å

PDB Description: Structure of 3-keto-L-gulonate 6-phosphate decarboxylase E112D/T169A mutant with bound D-ribulose 5-phosphate

PDB Compounds: (B:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1xbyb_:

Sequence; same for both SEQRES and ATOM records:

>d1xbyb_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

Timeline for d1xbyb_:

• d1xbyb_ first appeared in SCOP 1.73, called d1xbyb1
  
• d1xbyb_ appears in SCOPe 2.07