![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [75051] (14 PDB entries) Uniprot P39304 |
![]() | Domain d1xbxa1: 1xbx A:3-215 [121844] Other proteins in same PDB: d1xbxb_ complexed with 5rp, hms, mg; mutant |
PDB Entry: 1xbx (more details), 1.81 Å
SCOPe Domain Sequences for d1xbxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbxa1 c.1.2.3 (A:3-215) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa qqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfkg ipihvfiagrsirdaaspveaarqfkrsiaelw
Timeline for d1xbxa1: