SCOPe 2.08: Domain d1xbxa1: 1xbx A:3-215

Lineage for d1xbxa1 (1xbx A:3-215)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)

7. Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
   Uniprot P39304

8. Domain d1xbxa1: 1xbx A:3-215 [121844]
   Other proteins in same PDB: d1xbxb_
   complexed with 5rp, hms, mg; mutant

Details for d1xbxa1

PDB Entry: 1xbx, 1.81 Å

PDB Description: Structure of 3-keto-L-gulonate 6-phosphate decarboxylase E112D/R139V/T169A mutant with bound D-ribulose 5-phosphate

PDB Compounds: (A:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1xbxa1:

Sequence; same for both SEQRES and ATOM records:

>d1xbxa1 c.1.2.3 (A:3-215) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa
qqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

Timeline for d1xbxa1:

• d1xbxa1 first appeared in SCOP 1.73
  
• d1xbxa1 appears in SCOPe 2.07