Lineage for d1xbia1 (1xbi A:1-116)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525848Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2525849Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2525866Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2525933Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
    Uniprot P54066
  8. 2525938Domain d1xbia1: 1xbi A:1-116 [121840]
    Other proteins in same PDB: d1xbia2
    automatically matched to d1sdsa_
    protein/RNA complex; complexed with epe

Details for d1xbia1

PDB Entry: 1xbi (more details), 1.45 Å

PDB Description: high resolution structure of methanocaldococcus jannaschii l7ae
PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1xbia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbia1 d.79.3.1 (A:1-116) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]}
mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk

SCOPe Domain Coordinates for d1xbia1:

Click to download the PDB-style file with coordinates for d1xbia1.
(The format of our PDB-style files is described here.)

Timeline for d1xbia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xbia2