![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries) Uniprot P54066 |
![]() | Domain d1xbia1: 1xbi A:1-116 [121840] Other proteins in same PDB: d1xbia2 automatically matched to d1sdsa_ protein/RNA complex; complexed with epe |
PDB Entry: 1xbi (more details), 1.45 Å
SCOPe Domain Sequences for d1xbia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbia1 d.79.3.1 (A:1-116) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]} mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk
Timeline for d1xbia1: