Lineage for d1xb4c2 (1xb4 C:126-199)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635796Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 635797Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)
  7. 635798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
  8. 635804Domain d1xb4c2: 1xb4 C:126-199 [121837]
    automatically matched to d1u5tc2

Details for d1xb4c2

PDB Entry: 1xb4 (more details), 3.1 Å

PDB Description: crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
PDB Compounds: (C:) Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region

SCOP Domain Sequences for d1xb4c2:

Sequence, based on SEQRES records: (download)

>d1xb4c2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr
atmlkdendkviai

Sequence, based on observed residues (ATOM records): (download)

>d1xb4c2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsetvnwefhrmpesllyyclkplcdrnratm
lkdendkviai

SCOP Domain Coordinates for d1xb4c2:

Click to download the PDB-style file with coordinates for d1xb4c2.
(The format of our PDB-style files is described here.)

Timeline for d1xb4c2: