SCOPe 2.06: Domain d1xawa1: 1xaw A:416-522

Lineage for d1xawa1 (1xaw A:416-522)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.17: occludin/ELL-like [144292] (2 families)
   antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)

5. Family h.4.17.1: Occludin/ELL domain [144293] (1 protein)
   Pfam PF07303

6. Protein Occludin [144294] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries)
   Uniprot Q16625 416-522

8. Domain d1xawa1: 1xaw A:416-522 [121831]

Details for d1xawa1

PDB Entry: 1xaw, 1.45 Å

PDB Description: crystal structure of the cytoplasmic distal c-terminal domain of occludin

PDB Compounds: (A:) Occludin

SCOPe Domain Sequences for d1xawa1:

Sequence; same for both SEQRES and ATOM records:

>d1xawa1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]}
wireyppitsdqqrqlykrnfdtglqeykslqsvldeinkelsrldkelddyreeseeym
aaadeynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt

Timeline for d1xawa1:

• d1xawa1 first appeared in SCOP 1.73
  
• d1xawa1 appears in SCOPe 2.05
  
• d1xawa1 appears in SCOPe 2.07
  
• d1xawa1 appears in the current release, SCOPe 2.08