![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
![]() | Superfamily h.4.17: occludin/ELL-like [144292] (2 families) ![]() antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731) |
![]() | Family h.4.17.1: Occludin/ELL domain [144293] (1 protein) Pfam PF07303 |
![]() | Protein Occludin [144294] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries) Uniprot Q16625 416-522 |
![]() | Domain d1xawa1: 1xaw A:416-522 [121831] |
PDB Entry: 1xaw (more details), 1.45 Å
SCOPe Domain Sequences for d1xawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xawa1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]} wireyppitsdqqrqlykrnfdtglqeykslqsvldeinkelsrldkelddyreeseeym aaadeynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt
Timeline for d1xawa1: