SCOPe 2.06: Domain d1x9xa_: 1x9x A:

Lineage for d1x9xa_ (1x9x A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein Serine/threonine-protein kinase ste11 [101246] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries)

8. Domain d1x9xa_: 1x9x A: [121829]
   automated match to d1ow5a_

Details for d1x9xa_

PDB Entry: 1x9x

PDB Description: solution structure of dimeric sam domain from mapkkk ste11

PDB Compounds: (A:) Serine/threonine-protein kinase STE11

SCOPe Domain Sequences for d1x9xa_:

Sequence; same for both SEQRES and ATOM records:

>d1x9xa_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksf
qr

Timeline for d1x9xa_:

• d1x9xa_ first appeared in SCOP 1.73, called d1x9xa1
  
• d1x9xa_ appears in SCOPe 2.05
  
• d1x9xa_ appears in SCOPe 2.07
  
• d1x9xa_ appears in the current release, SCOPe 2.08