Lineage for d1x9jg2 (1x9j G:173-373)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995385Family c.55.1.2: Acetokinase-like [53080] (3 proteins)
  6. 995400Protein butyrate kinase 2 [142460] (1 species)
  7. 995401Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)
    Uniprot Q9X278 1-172! Uniprot Q9X278 173-375
  8. 995417Domain d1x9jg2: 1x9j G:173-373 [121824]
    automatically matched to 1SAZ A:173-375
    complexed with cit, gol, na, po4

Details for d1x9jg2

PDB Entry: 1x9j (more details), 3 Å

PDB Description: Structure of butyrate kinase 2 reveals both open- and citrate-induced closed conformations: implications for substrate-induced fit conformational changes
PDB Compounds: (G:) Probable butyrate kinase 2

SCOPe Domain Sequences for d1x9jg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9jg2 c.55.1.2 (G:173-373) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf
tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl
kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp
knyseesrrwrerydsyldgi

SCOPe Domain Coordinates for d1x9jg2:

Click to download the PDB-style file with coordinates for d1x9jg2.
(The format of our PDB-style files is described here.)

Timeline for d1x9jg2: