SCOP 1.73: Domain d1x9jf2: 1x9j F:173-372

Lineage for d1x9jf2 (1x9j F:173-372)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (3 proteins)

6. Protein butyrate kinase 2 [142460] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)

8. Domain d1x9jf2: 1x9j F:173-372 [121822]
   automatically matched to 1SAZ A:173-375
   complexed with cit, gol, na, po4

Details for d1x9jf2

PDB Entry: 1x9j, 3 Å

PDB Description: Structure of butyrate kinase 2 reveals both open- and citrate-induced closed conformations: implications for substrate-induced fit conformational changes

PDB Compounds: (F:) Probable butyrate kinase 2

SCOP Domain Sequences for d1x9jf2:

Sequence; same for both SEQRES and ATOM records:

>d1x9jf2 c.55.1.2 (F:173-372) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf
tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl
kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp
knyseesrrwrerydsyldg

Timeline for d1x9jf2:

• d1x9jf2 is new in SCOP 1.73
  
• d1x9jf2 appears in SCOP 1.75
  
• d1x9jf2 appears in the current release, SCOPe 2.08