SCOPe 2.08: Domain d1x9jb2: 1x9j B:173-371

Lineage for d1x9jb2 (1x9j B:173-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (4 proteins)

6. Protein butyrate kinase 2 [142460] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)
   Uniprot Q9X278 1-172! Uniprot Q9X278 173-375

8. Domain d1x9jb2: 1x9j B:173-371 [121814]
   automated match to d1saza2
   complexed with cit, gol, na, po4

Details for d1x9jb2

PDB Entry: 1x9j, 3 Å

PDB Description: Structure of butyrate kinase 2 reveals both open- and citrate-induced closed conformations: implications for substrate-induced fit conformational changes

PDB Compounds: (B:) Probable butyrate kinase 2

SCOPe Domain Sequences for d1x9jb2:

Sequence; same for both SEQRES and ATOM records:

>d1x9jb2 c.55.1.2 (B:173-371) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf
tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl
kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp
knyseesrrwrerydsyld

Timeline for d1x9jb2:

• d1x9jb2 first appeared in SCOP 1.73
  
• d1x9jb2 appears in SCOPe 2.07