Lineage for d1x9da1 (1x9d A:245-697)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645943Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
  5. 645944Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 645945Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 645956Species Human (Homo sapiens) [TaxId:9606] [48229] (4 PDB entries)
  8. 645957Domain d1x9da1: 1x9d A:245-697 [121810]
    automatically matched to d1fmia_
    complexed with bu1, ca, smd, so4

Details for d1x9da1

PDB Entry: 1x9d (more details), 1.41 Å

PDB Description: crystal structure of human class i alpha-1,2-mannosidase in complex with thio-disaccharide substrate analogue
PDB Compounds: (A:) Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

SCOP Domain Sequences for d1x9da1:

Sequence, based on SEQRES records: (download)

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnteahplpiwt

Sequence, based on observed residues (ATOM records): (download)

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddnllsldayvfnteahplpiwt

SCOP Domain Coordinates for d1x9da1:

Click to download the PDB-style file with coordinates for d1x9da1.
(The format of our PDB-style files is described here.)

Timeline for d1x9da1: