Lineage for d1x9da_ (1x9d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004342Species Human (Homo sapiens) [TaxId:9606] [48229] (4 PDB entries)
  8. 2004343Domain d1x9da_: 1x9d A: [121810]
    automated match to d1nxca_
    complexed with bu1, ca, smd, so4

Details for d1x9da_

PDB Entry: 1x9d (more details), 1.41 Å

PDB Description: Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB Compounds: (A:) Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

SCOPe Domain Sequences for d1x9da_:

Sequence, based on SEQRES records: (download)

>d1x9da_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnteahplpiwt

Sequence, based on observed residues (ATOM records): (download)

>d1x9da_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddnllsldayvfnteahplpiwt

SCOPe Domain Coordinates for d1x9da_:

Click to download the PDB-style file with coordinates for d1x9da_.
(The format of our PDB-style files is described here.)

Timeline for d1x9da_: