SCOPe 2.07: Domain d1x8uc_: 1x8u C:

Lineage for d1x8uc_ (1x8u C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d1x8uc_: 1x8u C: [121809]
   automated match to d1ngla_
   complexed with cm2

Details for d1x8uc_

PDB Entry: 1x8u, 2.2 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with carboxymycobactin t

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d1x8uc_:

Sequence; same for both SEQRES and ATOM records:

>d1x8uc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1x8uc_:

• d1x8uc_ first appeared in SCOP 1.73, called d1x8uc1
  
• d1x8uc_ appears in SCOPe 2.06
  
• d1x8uc_ appears in the current release, SCOPe 2.08